PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Brast08G023500.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family WOX
Protein Properties Length: 520aa    MW: 53738.1 Da    PI: 7.8167
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Brast08G023500.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox50.34e-16142202257
                         T--SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
            Homeobox   2 rkRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57 
                         + R+++ +eq+++Le+ F+    +ps+ee++++ ++l     + +++V++WFqNr+ + k+
  Brast08G023500.1.p 142 KARWSPRAEQIRILEAIFNGgAANPSREEIRRIRARLqefgPVADANVFYWFQNRKSRAKN 202
                         79*****************99****************99999****************995 PP

2Wus_type_Homeobox98.84e-32141203264
   Wus_type_Homeobox   2 artRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqk 64 
                         +++RW+P++eQi+iLe++++ G  +P++eei+ri+a+L+e+G + d+NVfyWFQNrk+R ++k
  Brast08G023500.1.p 141 TKARWSPRAEQIRILEAIFNGGAANPSREEIRRIRARLQEFGPVADANVFYWFQNRKSRAKNK 203
                         689**********************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.605.5E-7126202IPR009057Homeodomain-like
PROSITE profilePS5007111.272138203IPR001356Homeobox domain
SuperFamilySSF466898.32E-11138207IPR009057Homeodomain-like
SMARTSM003896.8E-7140207IPR001356Homeobox domain
PfamPF000461.1E-13142201IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 520 aa     Download sequence    Send to blast
MGKSKRAKQK EGGEEGGNGG IYCLAHTLAV AGSWAEGRER HYKQQEEESH SHASAQIHSV  60
PSSSSPLNRE APGPGMASSN KHWPSMFRAN PACGFQPQPQ SDMMYSSHGS SSLLSDAKPS  120
FLPSGMKDQQ EGSHGGRSTE TKARWSPRAE QIRILEAIFN GGAANPSREE IRRIRARLQE  180
FGPVADANVF YWFQNRKSRA KNKLRAAAAA ARQLAPSSSS PVPVTPPRKQ QQNLLLGSAN  240
NSSSSSSSSE RSSSSGGGKA AASVVQPPPT PLPPPVSGIG QLYYQYYPMR TPAAAREMVV  300
GSPEPQGQQY CYCLPATELG GVVLGSGGRH AAAIGQQDNM VENIDKGPSC CDTDGLLYSS  360
INAAGAAAAP EGVVSGAMMS GAAFTDDKAS WLGGGGLLHH ASAAASDVIS TAAPAPSVNA  420
AASSALTDQL QLQELLNAGG LNIGGECVAA PMATVVAMAA AGPNAGAVQC YSVPAMARLD  480
APRLFGEAAL LLRHTGEPVP VDAANGVTLD HGALYYVLV*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A0Q3MKL31e-130A0A0Q3MKL3_BRADI; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP26663470
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G33880.13e-28homeobox-3